SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000317232 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000317232
Domain Number 1 Region: 138-248
Classification Level Classification E-value
Superfamily FKBP-like 4.32e-36
Family FKBP immunophilin/proline isomerase 0.0003
Further Details:      
 
Domain Number 2 Region: 227-343
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-34
Family FKBP immunophilin/proline isomerase 0.00034
Further Details:      
 
Domain Number 3 Region: 358-455
Classification Level Classification E-value
Superfamily FKBP-like 2.16e-30
Family FKBP immunophilin/proline isomerase 0.00046
Further Details:      
 
Domain Number 4 Region: 37-104
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000000000373
Family FKBP immunophilin/proline isomerase 0.0012
Further Details:      
 
Domain Number 5 Region: 458-536
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000772
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000317232
Sequence length 550
Comment FKBP10 (Homo_sapiens) FK506 binding protein 10, 65 kDa
Sequence
MQPAGRPGRLPLLQALLALQAVGRALGRASPAGGPLEDVVIERYHIPRACPREVQMGDFV
RYHYNGTFEDGRKFDSSYDRSSLVAIVVGVGRLITGMDRGLMGAGAHPPRRHPVLRRGAG
GRVEQSGHGPGERSAAAAALAGDFVRYHYNGSLLNGVPFDSSYSRGGTYDTYVDSGWLIK
GMEQGLQGMCPGERRRVTIPPFLAYGEKGYGTVIPPQASLVFHILLVDVHNPKDTVQVDT
LELPAGCVRKAVPGDFMRYHYNGSLMDGSPFDSSYSRNHTYDTYIGQGYIIPGMDQGLQG
ACMGELRRITVPPHLAYGENGTGNKIPGSAVLIFHVLIVDFHNPSDPVGIETLLRPSEPC
NKTSKLGDFIRYHYNCSLMDGTRLFSSHDFAAPQEATLGANKVIEGLDRGLQGMCVGERR
RLVVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLPDGYLFVWHKDPPSSLFEDMDLN
KDGEVPPEEFSSFIKAQVQEGKGRLLPGQDPEKTIGDMFRNQDRDQDGRITAAELKLKSD
EDQERLHEEL
Download sequence
Identical sequences G5B0L8
HGL_H00000317232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]