SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000317257 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000317257
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.17e-17
Family PLC-like (P variant) 0.064
Further Details:      
 
Domain Number 2 Region: 231-437
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000667
Family Integrin A (or I) domain 0.024
Further Details:      
 
Domain Number 3 Region: 130-213
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000376
Family Synaptotagmin-like (S variant) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000317257
Sequence length 491
Comment CPNE1 (Homo_sapiens) copine I
Sequence
MMAHCVTLVQLSISCEHLIDKDISSKSDPLCVLLQDVGGATWVELGRTERIRNCSSPEFS
KTLQLEYHFETVQKLRFGIYDIENKTPGLGDDDFLGGAECSLGQIVSSQILTLPLMLKPG
KPAGQGTITVIKNNLNPAWKRFSIPLQHFCSGDYNTSIQVRCSDYDSDGSHDLIGTFYTS
LAQLQAVPAEFECIHPEKQQKKKSYKNSGTICVKICQVEREYSFLDYVIGGCQINFTVGM
DFTGSNGDPSSPDSLHYLSPTGVNEYLTALWSVDSVVQDYDSDKLSPVFGFGAQVPPDWQ
VSHEFALNFKPNNPYCAGQGIVDAYRKALPQVRLYGPTNFAPIINHVARFAAQAAYQRTA
SVSIVAILHVLLLLTDGAVTDVEATCQAVVNASKLPMSGIIVGVGGADFKAMEQLDADSR
PQHTGPGESAAHDIVQFVPYHQFQNAPREALAQTVLAEVPTQLVSYFKAQGWASLKMPPS
PAKVPAQAAQA
Download sequence
Identical sequences G5B847
HGL_H00000317257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]