SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000317327 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000317327
Domain Number 1 Region: 511-523,554-750
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 5.89e-28
Family Cofactor-dependent phosphoglycerate mutase 0.025
Further Details:      
 
Domain Number 2 Region: 389-454
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000427
Family SH3-domain 0.00092
Further Details:      
 
Domain Number 3 Region: 76-133
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000335
Family UBA domain 0.00034
Further Details:      
 
Weak hits

Sequence:  HGL_H00000317327
Domain Number - Region: 135-203
Classification Level Classification E-value
Superfamily LigT-like 0.00212
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000317327
Sequence length 774
Comment UBASH3A (Homo_sapiens) ubiquitin associated and SH3 domain containing A
Sequence
MRQCCRPPEPAKSGGQSDGDVGSLAGLLRVASVTPPVPMAPGQAVHIGALGSCLAHSRKE
EMAAGETQLYAKISNKLKGRSTPSLLDPLLALGFPAHTALKALAATGRRTVEEASTWLHS
HCNDPTLDDPIPQEYGLFLCPTGPLLERLEEFWRESKRQCARNRAHEVFPHVTLCEFFPC
EDQKVERLYEALKRAGDRVLVSFPAAIPLVLHSSASYLGFFIGDSPADVLREFAMVFSTE
AAVLAGGQPRMAAVGDLWPGAPACLTPCEDQKVERLYEALKRAGDRVLVSFPAAIPLVLH
SSASYLGFFIGDSPADVLREFAMVFSTEAAVLADCTVKPCTKQLHLTLAHKFYPHHQRTL
EQLARAVHPSQPRQWMAALFSRDMRFVHYQTLRALFQYKPQNMDELMLSPGDYIFVDPTQ
QEEASEGWVIGTSQRTGCRGFLPENYTERASEADTWTKHRTYTFSLAMDLNSRKDGEASG
QRNGEFHAPTSRSVSSIQASQARVAMARRSVLVVRHGERVDRVFGKSWLQQCSTLDGKYY
RPDLNFPRCLPSRSGGLKDFEHDPPLSSCGTFQARLAGDSLLDSGIRIMAVFSSPALGCV
QTAKHILEELKLEKTMKIRIEPGTFEWTQWEASEASPSFMTLAELREAGFNVDPGYRPAF
PLCSLLPAESYTQYADRCARSMERVLGACPPESGTILIVSHGSALDSCTRPLLGLPPRDC
GAFAQLVRKIPALGMCFCEENREEGKWELASPPARTLTHGANAAFSWRNWIPES
Download sequence
Identical sequences G5B2T4
HGL_H00000317327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]