SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000318177 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000318177
Domain Number 1 Region: 147-222
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.07e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000238
Further Details:      
 
Domain Number 2 Region: 54-134
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000367
Further Details:      
 
Domain Number 3 Region: 340-412
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.45e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000681
Further Details:      
 
Domain Number 4 Region: 240-312
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.55e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000318177
Sequence length 490
Comment FUBP3 (Homo_sapiens) far upstream element (FUSE) binding protein 3
Sequence
MKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRPLDDGVGNQLGALVH
QRAVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGIPERPCVLTGTPES
IEQAKRLLGQIVDRCRNGPGFHNDVDGNNTIQEILIPASKVGLVIGKGGETIKQLQERTG
VKMVMIQDGPLPTGADKPLRITGDPFKVQQAREMVLEIIREKDQADFRGVRGDFSSRLGG
GSIEVSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGVSPERAAQVMGPPDRCQHA
AHIINELILTAQERDGFGGLAVARGRGRSRGDWNMGTAGGVQEITYTVPADKCGLVIGKG
GENIKSINQQSGAHVELQRNPPPNTDPSLRIFTIRGVPQQIEVARHLIDEKVGVRTQPFP
NLANCSRTFFGISKVPVLPGTLHCLCLPSSRSGEQPTTWPRAGQWPREGQLLAGLRDHSS
SVHRACPMQA
Download sequence
Identical sequences G5AMV4
HGL_H00000318177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]