SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000318212 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000318212
Domain Number 1 Region: 251-426,456-517
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.12e-44
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Domain Number 2 Region: 521-705
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-43
Family cAMP-binding domain 0.00033
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-19
Family Flavin-binding PAS domain 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000318212
Sequence length 986
Comment KCNH6 (Homo_sapiens) potassium voltage-gated channel, subfamily H (eag-related), member 6
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKNSSRSLTQRLLSRSFLGSEGSHGRPGGQGPGPGRGKYRTVSQ
IPQFTLNFVEFNLEKHRSGSTTEIEIIAPRKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESQRGACGYTCSPL
TMVDLIVDIMFVVDIVINFRTTYVNSNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNGERPYLEPKIGWLDSLSTQLGKHYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRSLLQHCPAFRGASK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSMLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLPARPGKSSADVRALTYCDLHKIQWADLLEVLDMYPAFADSFWSKLEVTFNLRDVNGG
LQSSPQQNPSRQDHQGFFLNDNQSAGSPAPFQGYSLSGPGSPTSIVARPHAPGYPGAPPS
LGISDASGLWPELLQQMPPRHRPPNLQQGPDCWSQELGSRLEQLQAQMDRLESCMSSDLR
HILQLLQQSMPQSHTSYILEGPASNDLALFPSASATQSPRPTLTLGHLPPAQNLPYGDLN
RCAPKHRSSSSRMPHLAVAVDKTLMTSLEQEQPEGLLSPLASPLCPLEVQGLVCGPRFPS
LPEHLGSVPKQLEFQRYSSDPGFTRS
Download sequence
Identical sequences G5BDJ9
HGL_H00000318212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]