SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000318629 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000318629
Domain Number 1 Region: 326-381
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000000000049
Family VPS37 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.00000000262
Family UBC-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000318629
Sequence length 397
Comment VPS37A (Homo_sapiens) vacuolar protein sorting 37 homolog A (S. cerevisiae)
Sequence
MSWLFPLTKSAASSAAGAPSGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNN
LTININILLPPQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVSNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTAFPYLYSNSGGMPPYASQRFPFLPSYPPQEANRTITPLSVADTVS
SSTTSYTTAKPAAPSFGILSSLPLPIPTTDTSAPISQNGFGYKMPDVPDAFPELSELSVS
QLTDMNEQEELLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQIVLDK
YELLTQMKSAFEKKMQRQHELSESCSASTLQARLKVAAHEAEEESDNIAEDFLEGKTEID
DFLSSFMEKRTICHCRRAKEEKLQQVIAMHSHFHAPL
Download sequence
Identical sequences G5B8F2
XP_004853143.1.39548 HGL_H00000318629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]