SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000318912 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000318912
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.7e-98
Family Carbonic anhydrase 0.0000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000318912
Sequence length 262
Comment CA13 (Homo_sapiens) carbonic anhydrase XIII
Sequence
MSRLSWGYGEHNGPIHWNKFFPVADGDQQSPIEIKTKEVKYDSSLQPLRIKYDPSSAKII
RNSGHSFSVDFDDTQDKSALRGGPLTGSYRLRQFHLHWGSADDHGSEHMVDGVRYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGIFLQTGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLSLLPSSWEYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLANFRSLLCTSEGEAAA
FLLSNHRPPQPLKGRKVRASFR
Download sequence
Identical sequences G5ATX1
HGL_H00000318912 XP_004842045.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]