SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000319104 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000319104
Domain Number 1 Region: 348-467,517-756
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 1.7e-59
Family Tex N-terminal region-like 0.0092
Further Details:      
 
Domain Number 2 Region: 777-943
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.64e-22
Family Tex RuvX-like domain-like 0.0087
Further Details:      
 
Domain Number 3 Region: 958-1050
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000289
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 
Domain Number 4 Region: 1338-1429
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000265
Family SH2 domain 0.0033
Further Details:      
 
Domain Number 5 Region: 1239-1296
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000936
Family Cold shock DNA-binding domain-like 0.0099
Further Details:      
 
Domain Number 6 Region: 1063-1151
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000667
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000319104
Sequence length 1738
Comment SUPT6H (Homo_sapiens) suppressor of Ty 6 homolog (S. cerevisiae)
Sequence
MSDFVESEAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGNLKGFIND
DDDEDEGEEDEVSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRR
VKKMSDDEDDDEEEYGKEEHEKEAIAEEIFQDGEGEEGQEAVEAPMAPPEEEEEDDEESD
IDDFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYGEFEKYNEYDEELEEEY
EYEDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQL
RSIPVKGAEDDELEEEADWIYRNAFATPTISLQESCDYLDRGQPTSNFSRKGPSTIQKIK
EALGFMRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKM
QAYQYEQISADPDKPLADGIRALDTTDMERLKDVQSMDELKDVYNHFLLYYGRDIPKMQN
AAKASRKKLKRVREEGDEEGEGEEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFG
LTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREP
LVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDDQFLKMGLAE
DEGLLTIDISIDMKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQF
LYVQMAKELKNKLLAEAKEYVIKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIR
VLGIAFSSARDHPVFCALVNGEGEVTDFLRLPHFTKRRTAWREEEREKKAKPFSSNFLSI
QAQDIETLKKFLLNKKPHVVTVAGENRDAQMLIEDIKRIVHELDQGQQLSSIGVELVDNE
LAILYMNSKKSEAEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEH
VVKEELLNALYCEFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNN
TRLESRTQLVTMCHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARK
MAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRA
ELSCRYKDLRTAYRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAI
RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDK
VVKRPEERVKVGMTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAT
DHKQEEDMKRKQQRTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLT
VTWKVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLN
HKYYQDCSGGDRKKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVT
VTPEGFRYRGQIFPTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANINLADL
TRAVNALPQNMTSQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGGSAYHVFPTPA
QQPVATPLMTPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNS
HAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR
Download sequence
Identical sequences G5BVI0
HGL_H00000319104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]