SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000319591-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000319591-1
Domain Number 1 Region: 170-327
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.05e-37
Family Voltage-gated potassium channels 0.005
Further Details:      
 
Domain Number 2 Region: 39-142
Classification Level Classification E-value
Superfamily POZ domain 6.87e-32
Family Tetramerization domain of potassium channels 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000319591-1
Sequence length 327
Comment KCND3 (Homo_sapiens) potassium voltage-gated channel, Shal-related subfamily, member 3
Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIILNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAWMTTTQKTTRIITNVVETVPCGTVPGSKELPCGERY
SVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDV
SGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYA
EKGSSASKFTSIPASFWYTIVTMTTLG
Download sequence
Identical sequences G5BNX1
HGL_H00000319591-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]