SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000320025 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000320025
Domain Number 1 Region: 347-532
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.05e-50
Family Nucleotide and nucleoside kinases 0.0000000171
Further Details:      
 
Domain Number 2 Region: 163-272,311-346
Classification Level Classification E-value
Superfamily SH3-domain 1.26e-39
Family SH3-domain 0.00000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000320025
Sequence length 728
Comment CACNB2 (Homo_sapiens) calcium channel, voltage-dependent, beta 2 subunit
Sequence
MKATWFRLLKSAKGGRLKHSEICVSAGLARGDAVCFAFLLLHRQGGLVDLVDICTAAGEA
GVLSRQLLLNICWKVFGTVSLEEGGKVPAASVRFVGEGGRWRKSALQLCTAPPSRFNYEE
TWPGFQKAPLLECEDWEGMGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKT
KPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGF
IPSPVKLENMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGL
DAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLK
GYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLA
EVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRG
KSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSNLP
NPLLSRMLATSTLPISPSLASNSQGSQGDQRTERSAPARSASQPEEEPCLEPVKKSQHRS
SSSAPHHNHRSGASRGLSRQETFDSETQESRDSAYVEPKEDYPHEHVGHYAPHRDQSHRD
ESHGSGEHRRREARHRARDTDGEQEHSECTRQRSRHKSKDRYCDNDGDVTSKKRNEAGEW
ARDVYIRQ
Download sequence
Identical sequences G5BFD8
HGL_H00000320025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]