SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000320076 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000320076
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-31
Family Ankyrin repeat 0.00086
Further Details:      
 
Domain Number 2 Region: 379-440
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000404
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000320076
Sequence length 451
Comment USH1G (Homo_sapiens) Usher syndrome 1G (autosomal recessive)
Sequence
MNDQYHRAARDGYLELLKEATRKELNAPDEDGMTPTLWAAYHGNLESLRLIVSRGGDPDK
CDIWGNTPLHLAAANGHLHCLSFLVSFGANIWCLDNDYHTPLDMAAMKGHMECVRYLDSI
AAKQSSLNPKLVGKLKDKAFREAERRIRECAKMQRKHHERMERRYRRELAERSDALSFSS
LTSSTLSRRLQHLALGSQLPYSQATLHGTARGKTKIQRKLERRKQGGEGTFKVSEDGRKS
VRSLSGLQLGSDVMFVRPGTYANPKEWGRAPLRDMFLSDEDSVSRATLAAEPAHSEVSTD
SGHDSLFTRPGLGTMVFRRNYLSSGLDGTGTPRGRLQSSPSLDGDSLGSANSLQDRSCGE
ELPWDELDLGLDEDLEPDTSPLETFLASLHMEDFASLLRQEKIDLEALMLCSDLDLRSIS
VPLGPRKKIMGAVRRRRQALERPPALEDTEL
Download sequence
Identical sequences G5BND8
HGL_H00000320076 XP_004860673.1.39548 XP_004860674.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]