SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000320092 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000320092
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-67
Family BAR domain 0.000000186
Further Details:      
 
Domain Number 2 Region: 249-309
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-21
Family SH3-domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000320092
Sequence length 312
Comment SH3GL3 (Homo_sapiens) SH3-domain GRB2-like 3
Sequence
MERKIDVTNKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGD
CMLKYGKELGEDSTFGNALTEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIG
HHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKDLAERSMFNFLENDVEQVSQL
AVFVEAALDYHKQSTEILQDLQGKLQMRISAASSVPRREYKPRPVKRSSSELNGVSSTST
AKMTGSNIPVDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGIIHGESGFFP
INYVEVIVPLPQ
Download sequence
Identical sequences G5BF00
HGL_H00000320092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]