SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000320117 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000320117
Domain Number 1 Region: 10-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.26e-75
Family FCH domain 0.000000000158
Further Details:      
 
Domain Number 2 Region: 538-599
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000761
Family SH3-domain 0.0016
Further Details:      
 
Weak hits

Sequence:  HGL_H00000320117
Domain Number - Region: 397-466
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.000111
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000320117
Sequence length 602
Comment TRIP10 (Homo_sapiens) thyroid hormone receptor interactor 10
Sequence
MDWGAPRWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPTK
DDPESKFSQQQSFVQLLQEVNDFAGQRELVAENLSVRVCLELAKYSQEMKQERKMHFQEG
RRAQQQLENGFKQLESSKRKFERDCREAEKATQTAERLDQDINATKADVEKAKQQAHLRS
HMAEESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRTTRLGTGYGLLSGAELQ
VVPIIAKCLEGMKVAADAVDAKNDSQVLIELHKSGFARPSDVEFEDFSQPMNRAPSDSSL
GTPSDGRPEVRGTGRSRAKRWPFSKKNKPRPPSLSPLGGPPSSVLPNGPPSPRSGLDPLA
ILSEISKSVKPRLASFRSLRGGRGAVVTEDFSHLPPEQQRKRLQQQLEERNRELQKEVDQ
REALKKMKDVYEKTPQMGDPASLEPQITETLRNIERLKLEVQKYEAWLAEAESRVLSNRG
DSLNRHTRPPDPPASAPLDSSSNSNSGSQENKESSEEPPSEDGQDTPIYTEFDEDFEEPT
SPIGQCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKQGGEGYVPTSYLRVM
LN
Download sequence
Identical sequences G5C0N7
HGL_H00000320117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]