SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000320291 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000320291
Domain Number 1 Region: 542-788,829-942
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.18e-132
Family Oxysterol-binding protein 0.00032
Further Details:      
 
Domain Number 2 Region: 9-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-42
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 3 Region: 237-349
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000946
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000320291
Sequence length 950
Comment OSBPL1A (Homo_sapiens) oxysterol binding protein-like 1A
Sequence
MNTEAEHQLLHHARNGNAEEVRQLLESMERNEVMADINCKGRSKSNLGWTPLHLACYFGH
RQVVQDLLKAGAEVNVLNDMGDTPLHRAAFTGRKELVMLLLEYNADTTVVNGSGQTAKEA
THDKEIRNMLEAVERTQQRKLEELLLAAAREGKIADLTALLNRPNPPDVNCVDQLGNTPL
HCAAYRAHKQCAIKLLKSGADPNLKNKNDQKPLDLAQGAEMKHVLIGNKVIYKALKRYEG
PLWKSSRFFGWSLFWVVLEHGVLSWYRKQPDAAHNIYRQGCKHLTQAVCTVKSSDSCLFF
IKCFDDTIHGFRVPKNSLQQSRENWLEAIEEHSAYSTHYCSQDQMTEDEEEEAVSAVELK
ESLQKAQGCQQRLDMEISNFLKMIKEYDMAKEMLPSFLQKVEVISEASRETCAALGNCLR
LFTKQEEVRNLKLEQEQEKNKILSEALEALATEHHELEQSLVEGSPPPSILSEDEFYDAL
SDSESEKSLSRLEAVTAQSFEEEEEHVSSRKHRMSEGKDCGGGDALSNGIKKHRTSLPSP
MFSRNDFSIWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSFSDPV
ERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVRDDLGFRLISEQVSHHPPISAFHA
EGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHNEAYTWTNPTCCVHNIIVGKL
WIEQYGNVEITNHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKWTECLY
SVDPATFEAYKKNDKRNTEEKKNSKQMSSSEESDEMPMPDSESVFVIPGSALLWRIAPRP
PNSAQMYNFTSFAMVLNEVDREMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQ
RAARKNRSKSEEDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY
Download sequence
Identical sequences G5BLQ4
XP_012930713.1.39548 HGL_H00000320291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]