SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000320340 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000320340
Domain Number 1 Region: 487-817
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.49e-53
Family Diacylglycerol kinase-like 0.0085
Further Details:      
 
Domain Number 2 Region: 988-1105
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.26e-21
Family Ankyrin repeat 0.0015
Further Details:      
 
Weak hits

Sequence:  HGL_H00000320340
Domain Number - Region: 290-340
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000320340
Sequence length 1123
Comment DGKZ (Homo_sapiens) diacylglycerol kinase, zeta 104kDa
Sequence
METFFRKHFQQKAPNPGEGQRLPSSVGLPTSKARRRSPAGQASSSLAQRRRSSAQLQGCL
PVCGLGAQGASCRRRSSTAPPTRNPRFMVKEVPALQPAPVGAQCLGPPLLPAGLAGMKEG
QEEEGILAAEAMAGPSGSTQPGTGMPEPPTPRGPGPLLPVPRCLRRASTRLLPADVVYGH
TLWGLHGHYRRLSQLRPSGQQPGPGARRASGTSVGPVILARVCPLSRRRQVALRRKAAAG
PQAWSALLVKATTKSGLQHLAPPPPTLGAPCGESERQIRSTVDWSESATYGEHIWFETNV
SGDFCYVGEQYCVAKMLKSVPRKKCAGCKIVVHTPCIEQLEKINFRCKPSFRESGSRNVR
EPTFVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQ
IEEPCSLGVHAALVIPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEESRWRPFII
RPTPSPLMKPLLVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHN
LRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKIL
SHVEEGNVVQLDRWDLCAEPNPDAGPEERDEGATDRLPLDVFNNYFSLGFDAHVTLEFHE
SREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCI
VFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCR
EVLLTTAKAIPVQVDGEPCKLSASRIRIALRNQATMVQKAKRRSAAPLHSDQQPVPEQLR
IQVSKVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQESDGAGAKS
PTCQKLSPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASAQPDLPT
PPSPPGSRLSCSLRRSLQGDTVPPPGEALMEAAQRNDFCKLQELHRAGGDLLHRDSRGRT
LLHHAVSAGSKEVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHFIVEAGASLM
KTDQQGDTARQRAEKAQDTELAAYLENRQHYQMIQREDQETAV
Download sequence
Identical sequences G5ATB6
HGL_H00000320340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]