SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000320416 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000320416
Domain Number - Region: 201-258
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00213
Family VPS37 C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000320416
Sequence length 343
Comment VPS37D (Homo_sapiens) vacuolar protein sorting 37 homolog D (S. cerevisiae)
Sequence
MGPPSSTSVNLADLKEERQAGATLPKPQTQKRWVGRQTRRVQVVYTLWPVLMTSSPSSPH
VISSRANPKAPGLESQDPKSPAPYEWLEANIKDKPGPEEGSNGSKATQPDKTRAPSSQTH
PRTDHTSPSLPAWPQETQFQGLQLEREACLASNYALAKENLALRPRLEMGRAALAIKYQE
LREVAENCADKLQRLEDTMHRWSPHCALGWLQAELEEAEQEAEEHMEQLLLGEQSLEAFL
PAFQRGRALAHLRRTQAEKLQELLRRRERSTQPAPTAATDAPKPFPAAAVLPTGAARGPP
AVPRSLPPLDSRPVPPLKGSPGCPLGPAPLLSPRPSQPEPPHR
Download sequence
Identical sequences G5BG78
HGL_H00000320416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]