SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000320509 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000320509
Domain Number 1 Region: 321-376
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000264
Family Ankyrin repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000320509
Sequence length 714
Comment BANK1 (Homo_sapiens) B-cell scaffold protein with ankyrin repeats 1
Sequence
PGNTKGILVMYEEDAEDWAVYLRKLFSQAVETEGILLYRLEHFSLRHLESLSLTSYKCKL
LILSGSVLSDLTPKKCEFLEKMLDSPNSVVTLLCGLRSAAPLYESLNIPAGRWELSTEQQ
PRDYISVIQRVLFRDSEAYLEVSVPAEQRVNNPEEMKEKNKTEGSSGTSRSAVSLAMVLE
VPCENPGEIFIFLKDEVVGETVEAEFVSHAKYIRARLALWDKNVWCMKALDFPPGPVNVR
VYCDGILTATGEMKYSSPAMVVKGPTRAADSEGTLCWNDIEELDGILASIFKHEIPYYDF
QSLQSEICPQNEYMHINELPTLLHCAAKFGLKNLALHLLQCSGANWASKMKNTSGADPAH
IAKKYGHEELKKIFEDFSIQEISRNNEQLNDDEKDRASPSAYSPSSESTALHRGRRTKPR
QSEGVTDATEETGEGQEPEPGEDVQLSPTEGSSESSEDPYDDLYVFIPVTELDPEGEPPA
CCRPPLPSPRPACAALQPEKPPSASQGKTGESPVERSHNWNDFRARQETRDEPKGGEAKK
EDEKVQEAEEDPYTFAKIDENEYDMILSNMSVKKKPGSQSFIMNRPPAPTPRPTTTFPKE
ETMSYIAQVFQQKAARRQSDSDKSHGLPKKPDKARMESPAMSIPRGCLAAGQEELILLQE
KVKNGKLSVDEALEKFKHWQMGKSSLEMIQQEKLRQLRDNIIGKRPEEENICGK
Download sequence
Identical sequences G5BWS5
HGL_H00000320509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]