SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000320563 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000320563
Domain Number 1 Region: 2503-2793
Classification Level Classification E-value
Superfamily BEACH domain 1.27e-120
Family BEACH domain 0.0000000416
Further Details:      
 
Domain Number 2 Region: 2910-3073,3109-3154
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.26e-29
Family WD40-repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 2360-2485
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-18
Family PreBEACH PH-like domain 0.019
Further Details:      
 
Domain Number 4 Region: 465-654,838-878
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000475
Family MIF4G domain-like 0.054
Further Details:      
 
Domain Number 5 Region: 1058-1198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000697
Family Glycosyl hydrolases family 16 0.035
Further Details:      
 
Weak hits

Sequence:  HGL_H00000320563
Domain Number - Region: 256-509,571-596
Classification Level Classification E-value
Superfamily ARM repeat 0.0311
Family MIF4G domain-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000320563
Sequence length 3156
Comment WDFY4 (Homo_sapiens) WDFY family member 4
Sequence
MEAGEFPKAEDRAEDPGSQNEGQLDSPPGGQSPSPTALWDMLERKFLEYQQLAHGSPGHR
RSLLSLLPLFLKAWEHSVGIICFPSLQRLAEDVSNQLAQQIQRVLAGKPAEQARVAAGQL
LRWRGDMDQDGHLLLKSVYVLTGTDAKTLSRVAESGLPALLLQCLYLFFVFPVDKDELLE
SDLQGQRMFVQMLLNLCSEPQGLEGLLLGSELQSLLIATTCLREHSCRFWREPTFCVLRA
ISRVQSPSIIQYLQAADCMRLSVQNLSRLVDTLPAPEVSQAVSLVLSFVKDSYPISSALF
LEFENGEGYPLLLKVLLRYDGLTQGEVEPHLEELVGLVVWLTSCGSSELKVFDSITYPQL
EGFKFHQESSGVTVKNLQAFQVLQNVFHKASDSVLCTQVLLAIKTMWAWNPRNFFLLEWT
LQPISQFVELVPSKPTLVQVHFFQLLEALVFRLRYVPHEILRKVQHLIKESPQPSCTLVA
LQSILKITDSEPLFTDIFRDSGLLGLLLAQLRKQAKIMRKSGNKEPSPGIQDPERELTGV
MLRTVVALLKGSVRNAVVLKDHGMVPFIKIFLDDQCYREASLSILEQLAVINAEEYASII
VGALCSSTQGELQLKLDLLQSLLRILETPKGRAAFRVSSGFTGLLSLLSDLEGSLHEPPM
EAWGAVSRGQTLELLLHTLCALSAALHLDPVNSDFFRRHGLFEKLAEDLSSLGCFGAPEE
EGTPQHSWPDTKARPFAELLSTSFSPSCPLPARAQSCLQVLGFLDSMASGILHLRRDLRQ
PPATLSQKGQAAGGLQGSFKQWPDLEERPDEGDAVIMHPRIVCIMVKLLPLLYHEDHPQL
SEEIQCSVASHLLSLVKSEKSRQVMCEAGMLRTLVTSCQGVLRTGSSPLHVPLIRIFEKL
ASQAIEPDVLRQFLGLGIPLPLSAAVKHLKASPEGSGGTPGCSGQETSFFLLAAVGPPAT
DMRPSEGPADAIPGVAQDSTSSRMSWDSTPALQTALSLISMTSPRNLQPQRAALAPSFVE
FDMSVEGYGCLFIPTLSTVMGTSTEYSISGGIGTGGARPFPPPGGLTFSCWFLLSRQAIT
TEGHPIRFLTLVRHLARTEQPFVCFSASLCPDDLSLVVSTEEKEFQPLDVMEPEDAIDPS
PGRQLQVRCGQLLAFGQWHHLAVVVTKEMKRNCTISTYLDGQAIGSAKMLYIQALPGPFL
SMDPSSFVDVYGYIATPRIWRQKSSLIWRLGPTYLFEEAISMDTLEVIIKLGPRYCGNFQ
AVHTPGEDLDGEVKPLVAEEKVSFGLHVASSSITNVADLRNTYNEVDSRLIAKEMNISSR
DHTTPVFLLRNCAGHLLGSLRTLGAVAVGQLGVRVFHSSPAASSLDFIGGPAILLGLISL
ATDDHTMYAAVKVLHSVLTSNIMCDHLMQHISGYQILAFLLRKKTFLLNHHILQLILSVA
GTAELGFRPSAVTNMSVFQHILCDFELWTKTADNLELALLSHLMDILQSPSAHQAQLIPK
LVFLFNNPRLAPAKVPIIIGILGCQLKGHFSIQDLLRIGLFVVYTLKPSSVEETQVCVDG
APASSVPAGSQTSAKTIKLRNQLLEMLLGAMSSPQIHLSSESKEEMFLSLGPDWFLLLLQ
GHLHPSTTVLALKLLLHFLSSPSLRAQFKDGLSVGSWVERSAEGVTIIMDNLKSPEAVPE
HSHCLLPGFRVLTDFLSHRVHIPEIYFIVSTFFLQTPLTELKDGPKDSLDAMLQWLLQKH
HQQEVLRAGLCTEGALLLLEMLRATMSQPSAGCKEGTWEQTFPASVLYFLGLVHRTYPQD
PAWRAPDFLQTLATVTFPLGAQKDPVAESTGSTSPGPAAGGDSTMGGLQAAVTFHPGRRQ
LREFTQGLLRELLLRASSPKHSQQKRDFQSEVLLSTMEIFHTSSTGSTLLLQGSSEPQPS
MDAAPSLWNISHFAQRLVEKLYSGVFSADPKHILLFLMEHIMVVIENPSSQRDTVLSTLY
SSLNKVILYCLSKPQQSLSECLNLLSILGFLQAHWDIVFATYNSNVSFLLCLMHCLLLLH
ARSYPEGFGLEPKPRMTPYHQVFLSPNEEGKEKRDDEDIPSLNDAQHSIEKTVQALWKQL
VAQRRQALEDAFKIDLSVKPGESEVKIEEVTPLWEETMLKAWQHYLASERKSLASHSSIL
PHSKVSSWSGSLSTVIRLTPGRQAKEPECRAEDFVSCIENCRRRGQELYASLYQDHIQRQ
RCSNIKAAKAWDRIQEQLFGELGLWGQAAGEVMPCSQWELDWREGPARMRKRIRRLSPRE
VGSPGGCEESQDQKGDISQNYAEKQGELAPKEAECKLDEVALDCTQLTFFPALNESLHSE
DFLELCQERQVILQELPDGEKVTQKFSLVIVQGHLVSEGILLFGHQHFYLCENFTLSPTG
DIYCTRHCLSNISDPFIFNMCSKDRSSDHYSCQRHGYGDLRELRQACFLLQDIAMEIFFQ
NGYSKFLVFYNSDRSKVFKSFCSFQPSLKGKSTSEDPLNLRRPHSSDRTMLQRWQKRDIS
NFEYLMHLNTLAGRTHNDYMQYPVLPWVLADYTSETLNLTNPKTFRDLSKPMGAQTKERK
LKFIQRFKEVEKTEGDMTVQCHYCTHYSSAIIVASYLVRMPPFTQAFCSLQGGSFDVADR
MFHSVRSAWESASRENMSDVRELTPEFFYLPEFLTNCNAVEFGCMQDGTVLGDVQLPPWA
DGDPQKFISLHRQALESNFVSANLHHWIDLIFGYKQQGPAAVEAVNTFHPYFYGNRVDLS
SISDPLIKSTILGFVSNFGQVPKQLFTKPHPARSSMGKPSPGRDTATPSSLPSQPKPFLH
SLQSLKPSQVTVKDMFLFSLGSESPKGAIGHIVPTEKNILAVEKNKVLLPPAWNRTFSWG
FDDFSCCLGTYGSDKVLMTFEKLAAWGRCLCAVCPSPTVIITAGASAVVCVWELSVVKGR
PRGLHLRQALYGHTQAVTCLAASVTFSLLVSGSEDRTCILWDLDHLVHVVRLPAHRKGIS
AIAISDVSGTIVSCAGPHLSLWDVNGQPLASITTASGPEGAITCCCMVEGPTWDPSHVVV
TGSQDGMVRIWKTEDVKMSVPQQAAAEEPCMRPHSPRGHKWQKNLALCRELDVNLALTGK
PSKASPAVTALAASRNQPKLLVGDEKGRIFCWSADG
Download sequence
Identical sequences G5B0W4
HGL_H00000320563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]