SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000321029 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000321029
Domain Number 1 Region: 112-225
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000474
Family DnaQ-like 3'-5' exonuclease 0.016
Further Details:      
 
Domain Number 2 Region: 33-113
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000173
Family DnaQ-like 3'-5' exonuclease 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000321029
Sequence length 293
Comment EXD1 (Homo_sapiens) exonuclease 3'-5' domain containing 1
Sequence
MEKMKGENLKVCEPTSPALKAPIAPLLNDLKNSPSEEKEVTYTVIDQFQQKFGAAMLHIK
KQSVLSVAAEGPNVCRHGKLYWLQVIHDCRWLSDCLSHQYGIMLNNVFDTQVIHDCRWLS
DCLSHQYGIMLNNVFDTQVADVFQFSMETGGFLPNCISTLQQSLIRHLNVAPKYLSFLED
RQKLTQENPEVWFTRPLPPSLLKMLALEVTYLLPLRTALLDEMMSDLTTLVGGYLKPCRE
GSADQLAGAQPTCMELPEELLQLKDFQKQRRERAVKEYRMNARGLLIRTMLHP
Download sequence
Identical sequences G5BM09
HGL_H00000321029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]