SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000321049 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000321049
Domain Number 1 Region: 270-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-26
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 410-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 186-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-22
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 141-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 7 Region: 316-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000112
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 8 Region: 232-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000136
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000321049
Sequence length 478
Comment ZNF227 (Homo_sapiens) zinc finger protein 227
Sequence
AVTFKDVAVVFTTEELGLLDCTQKKLYEDVMVENFKNLVAVGHLPFKPDMVSQLEAEEKL
WMMETETQRSSMNQNEMETLRKFALKYLSHEELSCWQIWKHVASELTRCLHVTDSQLLQG
GCIQVSENEKNVKYPKGDSSRVHRGEKPYKCEECGKGFTQAAHFHIHQRVHTGEKPYKCD
VCGKGFSHNSPLVCHRRVHTGEKPYKCEACGKGFTRNTDLHIHFRVHTGEKPYKCKECGK
GFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYKCDVCGKDFSY
SSNLKLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEECNKSFSQAIDF
RVHQRVHTGEKPYKCGVCGKGFSQSSGLQSHQRVHTGEKPYRCEVCGKGFRYSSQFIYHQ
RGHTGEKPYKCEECGKGFGRSLNLRHHQRVHTGEKPHKCEECGKAFSLPSNLRVHLNV
Download sequence
Identical sequences G5CBN9
HGL_H00000321049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]