SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000321449-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000321449-1
Domain Number 1 Region: 63-144
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000151
Family Canonical RBD 0.019
Further Details:      
 
Weak hits

Sequence:  HGL_H00000321449-1
Domain Number - Region: 214-282
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0368
Family PhoB-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000321449-1
Sequence length 290
Comment RRP7B (Homo_sapiens) ribosomal RNA processing 7 homolog B (S. cerevisiae)
Sequence
MSQAWHFLLQKFLLQRKRAVQDTEGRIPSPLGYSAVPIKFSEKQQASHYLYVREHRVREG
AQSTWPQKRTLFVLNVPRYCSEESLSRLLSPCGLVQSVELQEKPDLAESPKEPKSKFFHP
RPVPGFRVAYVVFQRPSGVAAALILKGPLLVSTESHPVPSGIHEWISDYADAVADPEALR
VEVDAFMEAYDKKTAEEETEAKGEEGVPDKEGWVKVTRRGRRPVLPRTEAASLRVLERER
RKRARKELLNFYAWQHRETKWNTLVQLRKKFEEDKQRIELLRAQRKFRPY
Download sequence
Identical sequences G5BK57
HGL_H00000321449-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]