SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000321449-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000321449-2
Domain Number 1 Region: 125-166
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000107
Family Canonical RBD 0.019
Further Details:      
 
Weak hits

Sequence:  HGL_H00000321449-2
Domain Number - Region: 293-361
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.068
Family PhoB-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000321449-2
Sequence length 369
Comment RRP7B (Homo_sapiens) ribosomal RNA processing 7 homolog B (S. cerevisiae)
Sequence
MRRRRSRNAYASRAGLHLPAAPALRDSKMVARGRRKRAVQDTEGRLPSPLGYSAVPIKFS
EKQQASHYLYVREHRVREGAQSTGVVRMVQDKDPVPAVPIKFSEKQQASHYLYVREHRVR
EGAQSTWPQKRTLFVLNVPPYCSEESLSRLLSPCGLVQSVELQEKPDLVESPKEPKSKFF
HPKPVPGPLLVSTESHPVRSGIHSQYRWRCPVPPSWAWLGKGSFLGTHLLSAVSCPWVLV
GREWISDYADAVADPEALRVEVDAFMEAYDKKVAEEETKAKGEEGVPDEEGWVKVTRRGR
RPVLPRTEAASLRVLERERQKGARKELLNFYAWQHRETKMEHLAQLRKKFEEDKQRIELL
RAQRKFRPY
Download sequence
Identical sequences G5BPS1
HGL_H00000321449-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]