SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000321507 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000321507
Domain Number 1 Region: 315-550
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.79e-57
Family Alanine racemase-like, N-terminal domain 0.000000135
Further Details:      
 
Domain Number 2 Region: 525-683
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.01e-28
Family Eukaryotic ODC-like 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000321507
Sequence length 715
Comment AZIN1 (Homo_sapiens) antizyme inhibitor 1
Sequence
MGPTCLELTGDAGKEPGSLPPGGNGDCVSLVQTSDVGSGGLGRPASGSLSVTRDGGSLAA
PSLSSNLGLRHLHCHQLRLLAAFASMAHGSLAALRHQLHVLPSRWQAQQATTRGSAGTLL
QHKEEEPLHAGPADTGHCQRPVLQPQLPLALCHQRSSNKIQGLEGNIIIPEEELIQGHGI
VPGATQLVTMSFSPVLSLSLGRGYLASTPSVRRPAFATLLSSEVHNQVVKQDPTAHPDWR
PQKLGPYQGLNRRLDTTAFPMGDPWVPRCRLAALAPVDGCRSLFLDKLPLLSPLILNHLC
FVMLRTGGSAFFVGDLGKIVKKHSQWQSEAAQIRPFYVVRCNPSPAVLETLAALGTGFAC
SSKNEMALVQELGVSPENIIYISPCKQVSQIKYAAKTGVNIMTCDNEIELKKIARNHSNA
KVLLHLATEDGSGGEGSMKLGSTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYVH
ALSDARCVFDMAGEFGFTMSMLDIGGGFTGTAFQLEEVNHVIGPLLDVYFPEGSGIKIIS
EPGSYYVSSAFTLAVNIIAKKVVKNEKFPSGVEKTRSDEPAFVYYMNDGVYGSFASKLSE
DLNTIPEKYKEDEPLFASSLWGPSCDELDRVVESCLLPELHVGDWLIFANMGAASLQEAS
AFKDAPRPAVYYMMSFSDWYEMQDAGVTSDTMMKNFFFVPSCLQLSQDDGFPTEA
Download sequence
Identical sequences G5C0G8
HGL_H00000321507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]