SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000321556 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000321556
Domain Number - Region: 590-652
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00501
Family PLC-like (P variant) 0.063
Further Details:      
 
Domain Number - Region: 1725-1758,1839-1891,1940-1978
Classification Level Classification E-value
Superfamily TPR-like 0.00706
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000321556
Sequence length 2302
Comment DOCK6 (Homo_sapiens) dedicator of cytokinesis 6
Sequence
MARGVPVPPVLALLSKALNRNWLLGKPATSGTTQVPLTEVIEPLDFEDVLLSWPPDAEPG
PLRDLVEFPADDLELLLQPRESRTTKPGVPEDGMDAQARAAVEMYTEDWVIVHRRYQHLS
PAYSPTTADTQRERQKGLARQVFEQDTSGDERSSPEDAGQDDSRRCSGSPDDTPRSSGAS
GIFDLRNLAADLLLPSLLERAAPEEVDRRNEALRRQSRARALLTLYPAPDEEEAVERCSC
PEPPREHFGQRILVKCLSLKFEIEIEPIFGILALYDVREKKKISENFYFDLNSDSMKGLL
RAYGTHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQGDISECCEPYMVMKEVDTAKN
KEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSSAGQSDRDSDSEGERRPAWSERR
RRGPQDRSSGGDDACSFSGFRPATLTVTNFFKQEAERLSDEDLFKFLADMRRPSSLLRRL
RPVTAQLKIDISPAPENPHFCLSPELLHVKPYPDPRARPTKEILEFPAREVYAPHTCYRN
LLYVYPHSLNFSSRQGSVRNLAVRVQYMAGEDPSQALPVIFGKSSCSEFTREAFTPVVYH
NKSPEFYEEFKLRLPACVTENHHLLFTIYHVSCQPRPGTALETPVGFTWIPLLQHGHLRT
GPFCLPVSVDPPPPSYSVLTPDVALPGMRWVDGHKGVFSVELIATSSVHPQVALPGMRWV
DGHKGVFSVELIATSSVHPQDPHLDKFFTLVHVLEEGAFPFRLKDTVVNEGTVEQELRAS
LAALRLASPEPLVAFSHHVLDKLVHLVVRPPIISGQMVNLGRGAFEAMAHVVSLVHRSLE
VVQDTRGHCPVLAAYVHYAFRLPGAEPSLAGGAPPVMVQATTLSHGSGRPTSLYLTRSKS
ISSSNPDLAMAPGSVDDEVSRILASKALDRSSSRASSYLEGSSSTPPATQPRPTVQKLLH
EELALQWVVSGSTVREAVLQHAWFFFQLMVKSMALHLLLSQRLDTPRKLRFPGRFLDDIL
ALVGSVGLEVMTRVYKRLDTPRKLRFPGRFLDDILALVGSVGLEVMTRVYKDLELAGRLN
ASLAFFLSDLLSLVDRGFVFSLVRAHYKQVATRLQSAPNPAALLTLRMDFTRILCSHEHY
VTLNLPCCPLSPPASPSPSVSSTTSQSSTFSSQAPDPKVTSMFELSGPFRQQHFLAGLLL
TELALALEPEAEGASLLHKKAISTVHSLLCSHDTDPRYTEATVKARVAELYLPLLSLAQD
TLPRLHDFAEGPGQRSRLASMLDSDTDGEGDGGGTINPSVAMAIAGGPLPTGSRTSISHA
PPTASRPGCPLSAESSRTLLVCVLWVLKNAEPALLQRWAADLALPQLGRLLDLLYLCLAG
FEYKGKKAFERINSLTFKKSLDMKARLEEAILGTIGARQEMVRRSRERSPFGTQDNVRWR
KSITHWRQTSDRVDNSCTCMNTFSHIPERSPFGTQDNVRWRKSITHWRQTSDRVDKSKDE
MEHEALVDGNLATEASLVVLDTLEIIVQTVLLSEARESVLGAVLKVVLYSLGSAQSALFL
QHGLATQRALVSKFPELLFEEDTELCADLCLRLLRHCGSRISTIRTQASASLYLLMRQNF
EIGHNFARVKMQVTMSLSSLVGTTQNFSEEHLRRSLKTILTYAEEDVGLRDSTFSEQVQD
LMFNLHMILTDTVKMKEHQEDPEMLIDLMYRIARGYQGSPDLRLTWLQNMAGKHAELGNH
AEAAQCMVHAAALVAEYLALLEDSRHLPVGCVSFQNISSNVLEESAISDDILSPDEEGFC
SGKHFTELGLVGLLEQAATYFTMIKGQTGRGLGERDRIARGYQGSPDLRLTWLQNMAGKH
AELGNHAEAAQCMVHAAALVAEYLALLEDSRHLPVGCVSFQNISSNVLEESAISDDILSP
DEEGFCSGKHFTELGLVGLLEQAATYFTMGGLYEAVNEVCKNLIPILEAHRDYKKLAAVH
GKLQEAFTKILHQPPLLPMRLARGAAGYLPPSKDSRSSQPQRVFGTYFRVGFYGARFGDL
DEQEFEFYMERFGDDIVEIIKDSNPVDKSKLDPQKAYIQITYVEPHFDTYELKDRVTYFD
RNYGLRTFLFCTPFTPDGRAHGELHEQHKRKTLLSTEHAFPYIKTRIRVCHREETVLTPV
EVAIEDMQKKTRELAFATEQDPADSKMLQMVLQGSVGPTGPLEVAQVFLAEIPEDPKLFR
HHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELERHYCRLREALQPLLTQRLPQL
LAQVPAGLRNSLNRASLRKADL
Download sequence
Identical sequences G5BUI8
HGL_H00000321556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]