SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000321627 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000321627
Domain Number 1 Region: 307-397
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000369
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 2 Region: 178-241
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000552
Family Ankyrin repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000321627
Sequence length 802
Comment ANKFN1 (Homo_sapiens) ankyrin-repeat and fibronectin type III domain containing 1
Sequence
MLSKVPVSSTSTEAQPVEDDSPKALPVLGEQSNADNDINESLFIWGISDKAAQRKTISAY
EGLFHLQQEKQQPQPEPVHKLGRGWSLEQNQESYCVSKDLILSERRMNCRVKMTQQMQNL
HLSQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFRTRTDRLSLRKTSVNFQGNE
AMFEAVEQQDMDAVLLLLEQYTPEELDLNTPNSEGLTPLDIAIMTNNVPIAKILLRTGAR
ESPHFVSLESRTMHLNTLVQEAQDRVNELSAQVENEGLTLDNTEKQLKAWEWRHRLYRRM
KTGFEHARAPEMPTNACLMVTSSVSLTVTFQEPLSTNAAVVTRYKVEWSKSKDFCPLAGE
IIMDNLHTLRCTITGLITGQQYFVQVSAYNMKGWGPAQTTTPTCASPSNWKDCDDREPRH
KGQNEVLESLLQQVRALHQHYSCRESSKLQTAGRKQSVSRSLKHLFHSSNKFVKTLKRGL
YIAVVFYYKDNMLVTNEDQIPIVEIDDSHTSSITQDFLWFTKLSCMWEDIRWLRQSVPIS
MSSSTVLQTRQKMLAATAQLQNLLGTHNLGRVYYEPIKDRHGNILIVTIREVEMLYSFFN
GKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYHKRSHQRLSPGLYLGYLKLCSS
VDQIKVLVTQKLPNILCHVKIRENNNISKEEWEWIQKLSGSESMESVDHTSDCPMQLFFY
ELQMAVKALLKQINIPLHQARNFRLYTQEVLEMGHNVSFLLLLPASDDVCTAPGQNNPYT
PHSGFLNLPLQMFELGIVACFT
Download sequence
Identical sequences G5BPA8
HGL_H00000321627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]