SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000321679 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000321679
Domain Number 1 Region: 111-291
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.84e-42
Family Ankyrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000321679
Sequence length 309
Comment ANKRD23 (Homo_sapiens) ankyrin repeat domain 23
Sequence
MDFISIRQLVSGERDEEKVLGFGHSAPGPRGRPCDWRLGPHEAVAWEKLKQEEDKRLEKF
NSSRMNLETLADLENLIQRQRKKRLRRRVPPRESEPEAELQPQGQQKPVDLEMFLKAAAE
NQDSLIDKYLTDGGDPSAHDKLHRTALHWACLKGHSQLVSKLLAAGAAVDASDLLDKTPV
FWACRGGHLDILKQLLNQGVQVNARDKIWSIPLHVAVRTGHSDCLKYLVECGPHTDAQDK
IGGDLPSPHKGDTALHEAVCQSHYKAMKLLLLYGAKLGVQNVASLTPIQLAQDWQRGIRE
ALQAHIGHP
Download sequence
Identical sequences G5BMU8
HGL_H00000321679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]