SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000321963-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000321963-1
Domain Number 1 Region: 39-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.89e-21
Family SCAN domain 0.0019
Further Details:      
 
Domain Number 2 Region: 347-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 308-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000321963-1
Sequence length 421
Comment ZSCAN4 (Homo_sapiens) zinc finger and SCAN domain containing 4
Sequence
MALDLRKSFSHKPSSDDVESENLEFKSTQSSGVPKREISEFSSIEINSFQYSDNSGARKE
LQRLYHFFHSLLQPEKHTKEEIISQLAMEQFMLSGYCRDKSVLKKKWEASGRNLEKLMED
LTDDCMKPPVVVHVCMQGQEALFSEDMSLREVIVHLKKQLSAEALAGETLGTCSQGSQNA
PLETRQGSEYKDGCTNSWEITQEKDNITNPEEETVSPLIIPEENCPRPAEGGVSWENTHN
SGRARLGTCQLQEESAKASSYQDVPVDVGPGFFSRSDQSSPEPVPPNHSNDGNSTGEGHQ
EKFHGGQKSYKCEECPKTFVYLSHLLAHQRRHRNERPFVCAECNKGFFQTSDLRVHQMIH
KKEKPFTCSRCGKSFTHKTNLRAHERIHTGEKPYKCTLCHRSFRQSSTYYRHQKIHEKLP
S
Download sequence
Identical sequences G5B7M2
HGL_H00000321963-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]