SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000322016 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000322016
Domain Number 1 Region: 223-311,460-547
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.58e-28
Family Canonical RBD 0.0025
Further Details:      
 
Domain Number 2 Region: 126-201
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.34e-22
Family Canonical RBD 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000322016
Sequence length 556
Comment PUF60 (Homo_sapiens) poly-U binding splicing factor 60KDa
Sequence
QVNGQQGGGSEPAAAAAAAAAAVVAAGDKWKPPQGTESIKMENGQSTAAKLGLPPLTPEQ
QEALQKAKKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQR
ALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAA
QLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIK
SVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAV
TPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLATPGLVSPALTLAQP
LGALPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEE
LFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEV
TEECGKFGAVNRVIIYQEKQGEEDDAEIIVKIFVEFSMASETHKAIQALNGRWFAGRKVV
AEVYDQERFDNSDLSA
Download sequence
Identical sequences G5AWE4
HGL_H00000322016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]