SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000322273 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000322273
Domain Number - Region: 27-99
Classification Level Classification E-value
Superfamily Tropomyosin 0.0111
Family Tropomyosin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000322273
Sequence length 403
Comment OLFML3 (Homo_sapiens) olfactomedin-like 3
Sequence
MGLSSPLLILFLLSWSGPLRGQQHHLVEYMERRLASLEERLAQCQDQSSRHAAELRDFKN
KMLPLLEVAEKEREALRTEADSISGRVDRLEREVDYLETQNPALPCVELDEKVTGGPGTK
AKGRRNEKYDMMTDCSYTISQVRSMKILKRFGGPVGLWTKDPLGPTEKIYVLDGTQNDTA
FVFPRLRDFTLAMAARKASRVRVPFPWVGTGQLVYGGFLYYARRPPGGPGGGSELENTLQ
LIKFHLANRTVVDSSVFPAERLIPPYGLTTDTYIDLAADEEGLWAVYATREDDRHLCLAK
LDPQTLDTEQQWDTPCPREAAFIICGTLYVVYNTRPASRARIQCSFDVSGTLTPERAALS
YFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMRKKEEEV
Download sequence
Identical sequences G5ATD9
HGL_H00000322273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]