SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000323099 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000323099
Domain Number - Region: 528-664
Classification Level Classification E-value
Superfamily ARM repeat 0.00121
Family Armadillo repeat 0.038
Further Details:      
 
Domain Number - Region: 108-211
Classification Level Classification E-value
Superfamily Tropomyosin 0.0255
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000323099
Sequence length 788
Comment ATRIP (Homo_sapiens) ATR interacting protein
Sequence
MAGTTAQSSRRRPQALHPGPPPGPGHPPSKRARGFPVAAPLDPEDPFDAHGELTADDLEE
LDILASQALSQCPAAARDLSTVHKVRRLDGMSKSPAGKNTENAPVKDNFELEVLQTQYKE
LKEKLKVMEEEILIKNGEIKILRDSLHQSESILEEQKRSHFLLEQEKTQALSDKEKEFSR
KVQSLQSELQFKDAEMNELRTKFQSSERVNKLAAPSISHVSPRKNLSVVIRPEACSSQFG
KTSFPTKESFSANMSFPHPCQTEPGYKSLLGREDNKTHSLRSSPIKQEEVQKSLTDSWMQ
KSNTEGSILISLLLKQPLISGSAVGLCHLLSSCSEAPTGNLLQPLGLGSILAVISGLRTT
GSHSGAFSPSALREAQNLAFTGLNLIARNEGSCDGDPAEGPRRAFPLCQLPGAVHLLPLI
QFFIGLHCQALQELAVAKRSGASGDSSTHTSCVGSGVEANPEDLISNLEGFSVASLSILQ
HLVCHSGAVVCLLLSEVEADASSGEGNGSLVHRQTCGEIISAPMGAAEDQGQHPLLKMLL
HLLAFSSAAGGHLQASVLSQCLKVLVKLAENASSDFLPRFQCVLPVLPRCLSPETPLPCV
LLTIELLSLLVDHEILASQFCSHSEGCLLLLLYMYITSRPDKGTSETQWLQLEQEAVWLL
AKLGVQSSSSPVTGSDCQCNVEVVRALTVMLHRQWLTVRRAGGPPRTEWQKRTMRCLRDT
VLLLHSLSQKDKLFTVHCVEVLHQYDQVMPGVSTLIRGLPDVMDCEEAALDDLCGMETDA
DDAEMDCG
Download sequence
Identical sequences G5AVM3
HGL_H00000323099 XP_004833999.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]