SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000323148 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000323148
Domain Number 1 Region: 48-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.75e-39
Family SCAN domain 0.0000517
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 221-279
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000484
Family KRAB domain (Kruppel-associated box) 0.0089
Further Details:      
 
Weak hits

Sequence:  HGL_H00000323148
Domain Number - Region: 351-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00905
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000323148
Sequence length 563
Comment ZKSCAN1 (Homo_sapiens) zinc finger with KRAB and SCAN domains 1
Sequence
MTAESREATGLSPQATQEKDGIVIVKVEEEDEEDHMWGQDSSLQETPPPDPEIFRQRFRH
FCYQNTFGPREALSRLKELCHQWLRPEVNTKEQILELLVLEQFLSILPKELQVWLQEYRP
DSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEATQSHFK
HSSRKPRLLRSRAVPATHVPAPPHEGNPRDQAMASALLTADSQAMVKIEDMAVSLILEEW
GCQNLARRNLNRDSRQENYGNMFSQGRENRSENKESTSKGEDTQDSGSHGETAGRCQKDL
GEKREQPGRVVERQQRNPEEKTGKEKRESGPATAKEKKPTTGERAPREKGKGLGRSFSLS
SNFNNTPEEVPTGAKSHKCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQ
RIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHA
RERASEYSPTSLDAFGAFLKGCV
Download sequence
Identical sequences G5AN10
XP_004840288.1.39548 XP_012925998.1.39548 HGL_H00000323148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]