SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000324419-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000324419-1
Domain Number 1 Region: 353-487
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.12e-41
Family Synaptotagmin-like (S variant) 0.00000637
Further Details:      
 
Domain Number 2 Region: 215-327
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.36e-38
Family Synaptotagmin-like (S variant) 0.0000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000324419-1
Sequence length 491
Comment SYT9 (Homo_sapiens) synaptotagmin IX
Sequence
MPGARDALCHQALQLLAELCAHGALEHDSCQDFIYHLRDRTRPRLRDPDISVSLLTLVVT
ACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFIDPPT
PCLDSSMKISHTSPDIPLSTQPGVQENCAHGVRMQRQVTEPTSSARHNSIRRQLNLSNPD
FNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVK
IHKAINLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYSDLEA
RKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNDNVDLGELMFSL
CYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDSRRLKKRKTSTKRNTLNPVYN
EAIVFDVPPENIDQIHLSIAVMDYDRVGHNEIIGVCQVGNEAERLGRDHWSEMLSYPRKP
IAHWHSLVEVR
Download sequence
Identical sequences G5B7C4
HGL_H00000324419-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]