SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000324510 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000324510
Domain Number 1 Region: 972-1089
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.1e-24
Family Synaptotagmin-like (S variant) 0.011
Further Details:      
 
Domain Number 2 Region: 137-198,225-269,311-354
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.74e-23
Family Synaptotagmin-like (S variant) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000324510
Sequence length 1151
Comment BAIAP3 (Homo_sapiens) BAI1-associated protein 3
Sequence
PTMSTLLEIKSSVLRQVQVCPSFRRKTEPEPGSTSADLPEPATGAWKPGDGMEFFAHMRL
ILKKEEGRQGLPCPEVRPPLQACGQQGPETHPAAAGQGLRTWPPQVEMLYEEALYTVLHR
AGTMGPDQVDDEEILLGYIQQVFGTSPEEHIEAIERVKKAKAPTYTLKVSVMRAKNLLAK
DPNGFSDPYCMLGILPGSGTPREQSGQKEKRFSFRKGSKHSSPLPAKCIQVTEVKSSTLN
PVWKEHFLFEIEDVSTDQLHLDIWDHDDDVSLAEACRKLNEVIGLKGMSRYFKQIVKSAR
ANGTPGPTEDHTDDFLGCLNIPVREVPVAGTDRWFKLEPRSSASRVQGDCHLVLKLITTQ
RDTVMSQRGRSGFLSYLLLLSRIMQFEHRAEESNSSSWHGEFSAPGSTVLCLHGAQSNLS
PLQLAVLRHHQTCTLDYGYLLGLLEDMQAHWEEAASLPQEQEEILADSFSAFSEYGLKLL
RQLRDYFPATNSTAVYRLELLLKCLDKLQFFQPSFEMCPFETELNMDIAAALKRGNREWY
DRLLNTKSPREQPGPQRLTGLVELADIIYEDLQACYGIYASLFHGILKVDFFTLTFWQLE
HLLAEEAWVLTEELSPKMTLQVASGLIELYLTLADTQRFWSCIPGRDGRSLALAGIHTPF
LPAVKIWLQVLRDQVKWRLQGAVDVDTLEPVDTSSKHSSSAATASLCFSHIQELWVRLAW
PDPAQAQELGTQLSQDMCEAALFYSELLRKKVDTQPGAVGEAVSEPLCVVLNNVELVRRA
SGQALRGLAWPEGAGGVEAMLPRTLLSCTQALEEDLQREAHTVTAHLTSKMVADIRKYVQ
HISLSPDSIQNDEAVAPLMKYLDEKLALLNASLVKENLGRVLEALWELLLRAILRALGAN
SDVSADFYGRFHFTLEALVSFFHAEGQGLPLESLKDGSYKRLEEELRLHKCSTRECIEQF
YLDKLKQRALEQNRFGRLSIRCYYEAAEQRLTVEVLHAADLLPLDTNGLSDPFVIVELGP
PHLFPLVRSQRTQVKSRTLHPVYDELFHFSVSAEACRRRGACVLFTVMDHDWLSTNDFAG
EAALGLSGVSGISRPQVGGGMRAGQPITLHLRRPRAQVRSTLRMLEGRTNKEAQEFVKKL
KELEKSMEADP
Download sequence
Identical sequences G5BXT4
HGL_H00000324510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]