SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000324740-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000324740-1
Domain Number 1 Region: 218-483
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.73e-73
Family Protein kinases, catalytic subunit 0.000000000834
Further Details:      
 
Domain Number 2 Region: 156-249
Classification Level Classification E-value
Superfamily SH2 domain 2.63e-18
Family SH2 domain 0.00018
Further Details:      
 
Weak hits

Sequence:  HGL_H00000324740-1
Domain Number - Region: 110-148
Classification Level Classification E-value
Superfamily SH3-domain 0.000693
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000324740-1
Sequence length 512
Comment YES1 (Homo_sapiens) v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
Sequence
MRPSLPAVVGLPRRWRSKRAPQASPQPCERSRIADLIMAFIKSKEDKSPGIKYRTENTPE
PVSTGVGHYGAENTAAAPSSSVKDASANFSSLSLTPFGGSSGVTPFGGASSSFSVVPSSY
PAGLTGGVIIFVALYDYEATTTEDLSFKNVERFGEVWGGNVKHYKIRKLDNGGYYVTPRA
QFEKLQKLVKHYTEHADGLCHKLTTVCTTVKPQTQGLAKDAWEIPRESLLLEVKLGQGCF
SEIWMGTWNGSTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAIVSEEPIYIVT
EFMSKGSLLDFLKEGDGKYLKLPQLVDMAAHIANGMTYIERMNYIHRDLRAANILVGENL
VCKIADFGLARLVEDNEYTARQGTRFPIKWTAPEAALYGQFTIKSDVWSCGILQTELVTK
RRVPYPGMVNHEELEQVERGYRMPCPQGFPESLHELNLCWKKDPDERPTFEYIQSFLEDY
FTATEPVPARRKFIIQIAYFICTDLPKCKELV
Download sequence
Identical sequences G5ATT8
HGL_H00000324740-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]