SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000324827-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000324827-2
Domain Number 1 Region: 168-254
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000166
Family Canonical RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000324827-2
Sequence length 319
Comment AKAP17A (Homo_sapiens) A kinase (PRKA) anchor protein 17A
Sequence
MAAATIVHDTSEAVELCAAHGLYLKPITKMSISVALPQLKQPGKSISNWEVMERLKGMVH
SHQFSTLRISKSTMDFIRFEGEVENRSLVKAFLACLDGKTIKLSGFSDILKVRAAEFKLD
FPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFARREAGSEKPSEDVLVRVFQR
FGEIRNVDIPMLDPYREEMTGRNFHTFSFGGHLNFEAYVQYREYAGFIQAMSALRGMKLM
YKGEDGKAVACNIKAAPGQRRWADMCSPEPSTCRLLTQCAHSFMVSQVGLRWAAGRVEVS
LGPDAAAGLGPGPCGLLRT
Download sequence
Identical sequences G5BQS8
HGL_H00000324827-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]