SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000325018-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000325018-1
Domain Number 1 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.15e-27
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 407-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-24
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 183-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.08e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 466-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 508-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.52e-17
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 146-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000142
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Weak hits

Sequence:  HGL_H00000325018-1
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000109
Family KRAB domain (Kruppel-associated box) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000325018-1
Sequence length 557
Comment ZNF569 (Homo_sapiens) zinc finger protein 569
Sequence
MLENYNNLITVGYPFTKPDVIFKLEQEEDPWVVEEEVLRRHCPGEIWGIDEHQKTQDRFL
KQFFKKTLTEEEVNECHKKFTNAFPLNSDFIPSRYNLYEYDLFQNYLEHNFDCHNNVKCL
IRKEHFEYNGAVSSYGNSSSPLVVTPFKCNHCGRGFSQTLDLIRHLRIHSGEKLYECNKC
QKAFSHKEKLIKHHKIHSREQSYECNECGKTFIKMSNLIRHQRIHTGEKPYACNECGKSF
SQKSNLIDHEKIHTGEKPYECNECGKAFSQKQSLIAHQKVHTGEKPYACNECGKAFPRIA
SLALHMRSHTGEKPYKCDKCGKAFSQFSMLIIHVRIHTGEKPYECSECGKSFSQSSALTV
HMRSHTGEKPYECEECRKAFSHKKNFITHQKIHTKEKPYECNECGKAFIQMSNLVRHQRI
HTGEKPYICKECGKAFSQKSNLIAHEKIHSGEKPYECNECVHMRGHTGEKPYECNKCGKA
FSQSSSLTIHIRGHTGEKPFDCTKCGKAFSQISSLTLHMRKHTGEKPYNCIECGKAFSQK
SHLVRHQRIHTHQKQCL
Download sequence
Identical sequences HGL_H00000325018-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]