SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000325018-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000325018-2
Domain Number 1 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-26
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 141-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.51e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 60-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 109-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000019
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000325018-2
Sequence length 409
Comment ZNF569 (Homo_sapiens) zinc finger protein 569
Sequence
MLECLQPESDLTQHDEIHTGKQLYECKACKRTFSLKQNFIEHKKMHTGEKSHECTECGKV
FSQVSSLTLHLRSHIGKKSYECNKCGKAFSQKGNFLSHQKYHSGEKPSECEKAPVQMATL
IRHQRDHTGNKPYACKECGKAFNSKSYLSEHEKIHTGEKPFECNQCGRAFSQKQHLIKHQ
NIHSGKKPFKCNECEKAFSQKENLISHQRIHTGEKPYECKGCGKAFIQKSGLIRHERSHT
GEKPYTCKECGKAFSGKSNLTEHEKIHIGEKPYKCNECGTIFRQKQYLIKHHNIHTGEKP
YECNKCGKAFSRITSLIVHVRIHTGDKPYECKICGKAFCQSSSLTVHEKPHTGEKPYGCN
ECGKAFSQFSTLGLHMRIHTGEKPYQCSECGKAFSQKSHYVRHQRIHTH
Download sequence
Identical sequences G5BWF1
HGL_H00000325018-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]