SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000325123 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000325123
Domain Number 1 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.15e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 524-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 72-136
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.21e-21
Family SCAN domain 0.0003
Further Details:      
 
Domain Number 8 Region: 218-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 574-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000143
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000325123
Sequence length 609
Comment ZSCAN2 (Homo_sapiens) zinc finger and SCAN domain containing 2
Sequence
MMAAEVPAATAPLSPLFQVPPEEEDQEEDVATTVVLEDDSWVQEAVLQEDGPESELLAQS
AGKGGWQEEAAAGGPQGALSRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESS
EEAEALVEDLTQTLRDGDFEIQRKNGENSNPDMFEMFSGIPEGDCGQPSDRDSDSDRDCG
PKRARGDATTGEDAREAPAQGREVGQFIGLQGTYLGEKPYECTQCGKTFSRKSHLVTHER
THTGEKYYKCDECGKSFSDGSNFSRHQTTHTGEKPYKCRDCGKSFSRSANLITHQRIHTG
EKPFQCAQCGKSFSRSPNLIAHQRTHTGEKPYSCPECGKSFGNRSSLNTHQGIHTGEKPY
ECKECGESFSYNSNLIRHQRIHTGEKPYMCPDCGQRFSQSSALITHRRTHTGEKPYQCGE
CGKSFSRSSNLATHRRTHLVEKPYKCGECAKSFSQSSSLIAHQGTHTGEKPYECLTCGES
FSWSSNLIKHQRVHTGEKPYACDECGKSFSQRSQLVVHQRTHTGEKPYPCLMCGKSFSRG
SILLMHQRAHLGDKPYRCPECGKGFSWNSVLIIHQRIHTGEKPYECPKGFSNSSNFITHQ
RTHMKEKLY
Download sequence
Identical sequences G5B1S4
HGL_H00000325123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]