SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000325128-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000325128-3
Domain Number 1 Region: 5-226
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.05e-61
Family Rhodopsin-like 0.0042
Further Details:      
 
Domain Number 2 Region: 225-326
Classification Level Classification E-value
Superfamily ALDH-like 7.85e-26
Family ALDH-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000325128-3
Sequence length 355
Comment OR4A16 (Homo_sapiens) olfactory receptor, family 4, subfamily A, member 16
Sequence
MGYSNNVTEFVLLGLTQDPSAQNALFVMFLIIYTVTILGNLLIMVTVLASPSLGSPMYFF
LAYLSLIDAVYSTVYSPKLLIDLLNDRKTISFPACMVQIFIEHLFAGAEVFLLVVMAYDR
YVAICKPLHYLTIMNRQVCILFLVVSWAGGFAHSVIQLVFVSSLPFCGPNVMDHFMCDMY
PLLELACTDTYLIGLTVVANGGLICMVIFFLLLISYGIILNALKTHEYGNLELCIEVVDS
VQEDIDHIHKYGSSHMDVIVTENEKTAEFFLWHADSACVFWNACTCFSDGYCFGLGAEVG
ISTSQTHARGQVGLEGLLTTKWLLHGQDYVVSDFSEHGSLKYLHENLPVPQRNTN
Download sequence
Identical sequences G5BIW8
HGL_H00000325128-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]