SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000325296 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000325296
Domain Number 1 Region: 161-215,253-361
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000033
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Weak hits

Sequence:  HGL_H00000325296
Domain Number - Region: 391-460
Classification Level Classification E-value
Superfamily EF-hand 0.000496
Family Penta-EF-hand proteins 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000325296
Sequence length 560
Comment PKD2L1 (Homo_sapiens) polycystic kidney disease 2-like 1
Sequence
MCTKPVTYGMTSSSAYYCTKVMAELFLYTPSDPGVSFQAIGSMGDFWDDPLLDSSYWTKW
YNNQSLGHGSHSFICYENLLLGVPRLWQLQVRNDSCVVHEDFCGDILNCYEVHSPVKEEQ
LPFGPLNGTALMVEFPATGGAIPFWQIRIVKLIHYVSNWDFFIIGCKIVFCIFIFYYGVE
EILELHLHRLYYFTSIWNIVDLVVILLSIVAVGFHIFRTLEVNRLIGKLLEQPNTYADFE
FLAFWQTRYNNTNAVNLFFAWIKIFKYISFNKTMTQLSSTLACCAKDILGFAIMFFIVFF
AYAQLGYLLFGMQIILGDFGYNAINNANCILGPVYFVTYVFFIFFILLNMFPAIINDTYS
EVKEELAGQMDELQLSDLLKQGYNKTLTVLHLRKEQVSDVQKVFQGGEQEIQFEDFTNTL
KELGHTEHEITERMAAFTRFDQDRNCILDEKEQEQMQQDLEKERVALNAEIENLGQPIVY
GKPPHRPYFCFLGPSQTLHGLTKRVLQLETVLEGVMSQIDALGSELKMLERKGQLTPSLG
VEEQAIWEHLPSAPAATPSF
Download sequence
Identical sequences G5B0T0
HGL_H00000325296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]