SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000325355 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000325355
Domain Number 1 Region: 8-33,111-337
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-60
Family Ankyrin repeat 0.0000428
Further Details:      
 
Domain Number 2 Region: 625-694
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.95e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 556-621
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.36e-16
Family SAM (sterile alpha motif) domain 0.0043
Further Details:      
 
Domain Number 4 Region: 340-420
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000105
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000325355
Sequence length 1263
Comment CASKIN2 (Homo_sapiens) CASK interacting protein 2
Sequence
MGREQDLILAVKNGDVIGVQKLVAKVKATKTRPPVPALAATGHLPVCTCCGEAVPQPLCL
VPAQLSQEPVGAEVAEDPLRPRGMVGSSSLAPRRGSMSTTRMLMELLGSTKRLNVNYQDA
DGFSALHHAALGGSLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAA
VNAASLDGQIPLHLAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLL
LNSHLCVALLEGEAKDPGDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHE
AALYGKTEVVRLLLEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVR
ALKDFWNLHDPTALSVRAGDVITVIEQHPDGRWKGHIHESQRGTDRVGYFPPGIVEVVSK
RVGIPMPRLPSVPTPLRPGFSRMPQPPADEPLHPFTYGQLPRVGLSPDSPAGDRNSVGSE
GSVGSIRSAGSGQSSEGTNGHGTGLLIENAQPLPSAGEDQVLPGLHTPSLADNLSHRPLA
SYRSGEIVTQEVRPEQLLEGKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDL
TAIGVTKPGHRKKIASEISQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMG
LVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLLQGEALGEGRHRLARGPELMAI
EGLENGEAPAMAGPRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGS
GHSQEQPAPQPSGGDPSTPQERNLPEGTERPPRLCSPLPGQGPAPYVFMYPQPSPTSPAP
GPPPGAPRAFSYLASSPATPPDPPRPKRRSHSLSRPGPTEGEPEGEAEGPVGSALGSYAT
LTRRPGRSTLARTSPSPTSTRWAPRSQSFALRARRKGPPPPPPKRLSSVSGPTDPPPPDR
SPGPKEGSTEPRRRTLSEPAGPSEAPSLPIPAGPASDTEEEPGSEGTPPSRGSSGEGLPF
AEEGNLTIKQRPKPAGPPLRETPVPPGLDFNLTESDTVKRRPKCKEREPLQTALLAFGVA
SATPSPSAPLTAQAPSEPPSSASSSPAQPEPSSLPTQGAPALAPSPGTQPSGPPASCPAL
GPETESQAAPAALLKVPRAGTAPKPVSVACTQLAFSGPKLAPRLGPRPVPPPRPENTGAA
GAGRAQQRLEQTSSSLAAALRAAEKSISAEERDGDPGTCTKHILDDISTMFDALADQLDA
MLD
Download sequence
Identical sequences G5BNB3
HGL_H00000325355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]