SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000325376 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000325376
Domain Number 1 Region: 636-715
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.31e-24
Family Canonical RBD 0.0029
Further Details:      
 
Domain Number 2 Region: 174-283
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-22
Family Canonical RBD 0.003
Further Details:      
 
Domain Number 3 Region: 68-175
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-20
Family Canonical RBD 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000325376
Sequence length 717
Comment HNRNPM (Homo_sapiens) heterogeneous nuclear ribonucleoprotein M
Sequence
MAAGVEAAAEVAATEPKMEEESGAPGVPSGNGAPGPKSEGERPTQNEKRKEKNIKRGGNR
FEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFK
MEESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMINIP
PSILNNPNIPNEIIHALQAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKD
GKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHG
LGGIGMGLGPGGQPIDANHLNKGIGMGNLGPAGMGMEGIGFGINKIGGIEGPFGGGMENM
GRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRIGGAGMERMG
AGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGPLGLDHMASSIERMGQTMERIG
SGVERMGAGMGFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLGMERMVPAGMGAG
LERMGPVMDRMATGLERMGANSLERMGLERMGANSLERMGPAMGPALGAGIERMGLAMGG
AGGASFDRAIEMERGNFGGSFAGSFGGAGGHAPGVARKACQIFVRNLPFDFTWKMLKDKF
NECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGREIDVRIDRNA
Download sequence
Identical sequences G5B4L7
HGL_H00000325376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]