SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000325618 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000325618
Domain Number 1 Region: 777-960
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.5e-36
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.042
Further Details:      
 
Weak hits

Sequence:  HGL_H00000325618
Domain Number - Region: 18-114
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00069
Family Canonical RBD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000325618
Sequence length 1119
Comment PARP10 (Homo_sapiens) poly (ADP-ribose) polymerase family, member 10
Sequence
MFHFRVVMAEEAVGVAVEVHGLTPHVPDELLTLYFENRRRSGGGPVLSWQRLGHGGILTF
REPEDAQRVLDQAKHQLQGAWLCLRPAPPCASTRLLLQGLPPGTTPQRLEQHVQALLCAI
GHPVQPCHALASPRPDRALVQLSMPLPEADFRILEEQAQNLDLDGASVSLARVPQARAVR
VIGDSLPVDLLLLELYLENERRSGGGPLEGLHSLPRQLGTVISFQQWQTAEQVLQRNHWL
QGSELSLVPHYEVLEPEELAEGTAGGDHPSTMGPGAIHYALPEAGRLAGSLKGAVDSGEA
PGQLRSSLGKSHEGSPGQVMLADLGAVRSLEQERLVNQGPMGLLEQEGPMSLGTIGSAKQ
AGLKSPEPKGCAGPVGPMEISMRLLGQEDPGPLDLAEEEALLGAAMSSLGQEGLVWPVEI
TMKSPEKAGLESPGHVGLLGQAGLVEMVLSMEPGAMRFLQLYHEDLLASLGDVTLFPLEG
IDVTGFRGLEAQFQCVFGTEQLANATVDMKPEEVDPTEALQVLPAHSHTLWLLESTGSDQ
ENVSLEEVQEMLATLESLDSEHWQPLELREEKPEEQPEDAATPGQEEEATVPGAGEEPVA
PNIGTPEPEQLKEEAALQLALYHSLESQDWVAEQKEAATLRRALALSLLEAEEPLGGSTG
NGAQLVVHVPFEQDVEELDRALMTALEEHLQEETVRLQGHVLPEELCAPLERYHGVSVAP
QGDSILLRGFGAQPARAARHLAALLAGPWNSSLAFPFGGSDTTLPEQRLEEPLGRLESLA
ESTREFQEVVKAFCDSLDAAHSRICIIQVQRVSHPLLEQQYQLHRDRLVQRCTQQPAEQV
LYHGTSASTVPEICEHGFNRSFCGRNGTLYGRGVYFAKRASLSVQDRYSPPNDDGHKAVF
VARVLTGDYGQGCRSLRAPPLRAGHTLLRYDSAVNCLQQPSIFVIFHDTQALPTHLITCK
RLPHASRDSSRPGSGSAVLGALAVGAMSGEDSEVRAVAEGGSNGGSGSPSPGDTLPWNLG
KTQRSRRSGGGSGGNGSVLDPAERAVIRIAGMAALRTSIPPPDEQDFIQAYEEVREKYKV
YLGWVVSLLGQWAPELDYCTLGRPWETSLTLMLCAAASA
Download sequence
Identical sequences G5C5U5
HGL_H00000325618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]