SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000325905 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000325905
Domain Number 1 Region: 9-99
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.13e-24
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 91-126
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000325905
Sequence length 238
Comment SRSF7 (Homo_sapiens) serine/arginine-rich splicing factor 7
Sequence
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRSR
SGSIKGSRYFQSRSRSRSRSRSLSRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
Download sequence
Identical sequences A0A1S3FBT7 A0A250XWT4 A0A286X9I9 G1SL16 G5CA70 I3M452
ENSCPOP00000010600 10141.ENSCPOP00000010600 ENSCPOP00000010600 HGL_H00000325905 ENSSTOP00000003936 ENSOCUP00000003539 XP_003795721.1.62490 XP_004582801.1.84141 XP_004627684.1.9945 XP_004660110.1.11716 XP_004839378.1.39548 XP_005005111.1.53824 XP_005324603.1.77405 XP_005390946.1.28644 XP_008252728.1.1745 XP_008573512.1.73410 XP_008829743.1.79516 XP_010603269.1.5607 XP_012873417.1.60039 XP_015335227.1.40921 XP_020017572.1.5219 ENSSTOP00000003936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]