SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000326128 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000326128
Domain Number 1 Region: 152-235
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-21
Family La domain 0.0000481
Further Details:      
 
Domain Number 2 Region: 229-308
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000337
Family Canonical RBD 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000326128
Sequence length 745
Comment LARP4B (Homo_sapiens) La ribonucleoprotein domain family, member 4B
Sequence
MTSDQDTKVVAEPQAQRIQEGKDSSHLMNGPISQTTSQTSSIPALSQVPTTKVSELNPNA
KVWGTHMLHLEASNAAVGVSATWEEVPGSQADCSPQGLDASGDGDRSHENAAFPDVQESD
QTDMNTLALDNSEYESLPENNETGGNESQPESQEDPREVLKKTLEFCLSRENLASDMYLI
SQMDSDQYVPITTVANLDHIKKLSTDVDLIVEVLRSLPLVQVDEKGEKVRPNQNRCIVIL
REISESTPVEEVEALFKGDNLPKFINCEFAYNDNWFITFETEADAQQAYKYLREEVKTFQ
GKPIKARIKAKAIAINTFLPKNGFRPLDMNLYTQQRYTTSFYLPPVYSPQQQFPLYSLIT
PQTWSATHSYLDPPLVTPFPNTGFINGFTSPTFKPATSPLTSLRQYPPRSRQVPKMIQNP
SKSHLRHAIPSAERGPGLLESPSIFNFTADRLINGVRSPQTRQTGQNRTRIQNPSAYGKR
DIGTGRVEPSSLESSPGLGRGRKNSFGYRKKREEKFASSQTQSPTPPKPPSPSFELGLSN
FPPLPGAAGNLKTEDLFENRLSSLIVGSSKERSLNADASTNTIPAVPRESSVPASCAVSA
IYERSPSPAHVPEDPKVVEKQKEAHSVDRLPSALTTTTCKSVQVNGATTELRKPSYAEIC
QRTSKEPPSSPLQPQKEQKPNTVSCGKEEKKLAEPVERYREPPTLKSTPGAAPKDQRRQP
GRRPSPPAVGKRLSREQNTPPKSPQ
Download sequence
Identical sequences G5BUS9
HGL_H00000326128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]