SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000326227 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000326227
Domain Number 1 Region: 355-701
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.92e-91
Family YicI catalytic domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 705-779
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.09e-17
Family Putative glucosidase YicI, domain 3 0.0093
Further Details:      
 
Domain Number 3 Region: 83-180,223-353
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000000000229
Family YicI N-terminal domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000326227
Sequence length 888
Comment GANC (Homo_sapiens) glucosidase, alpha; neutral C
Sequence
MSCAEPNTQWKYILKIFYPLNCVEDEAVDKDSFRDCSKIAFYRRQKQQLSKNSTYRALLD
SVTIGRESTTFQIINEATKHPLLAEVYGIERNIIRLKINEETPLKPRYEVSDVLVGKLST
VRLISCSGDTESLILSDGKGDLKCHITANPFKIDLVSEKEVIMSINSLGQLYFEHLQIPE
KQRTTKENEKSTSIDTSQEDQEDLGLWEEKFGNFLDVKANGPASIGLDFSLHGFEHVYGI
PQHAESHQLKNTRDGDAYRLYNLDVYGYQIHDKMGIYGSVPYLLAHKLDRTIGIFWLNAS
ETLVEINTEPAAEYTLTQVGPAAAKQKVRSRTDVHWISESGIIDVFLLTGPTPSDIFKQY
SCLTGTQVMPPLFSLGYHQCRWNYEDEQDVRAVDAGFDDHDIPYDVMWLDIEHTEGKRYF
TWDKKRFPNPKRMQELLRSKKRKLVVISDPHIKVDPDYSVYTKAKEQGFFVRTCEGGDFE
GVCWPGLSSYLDFTNPKVREWYSGLFAFPAYQGSTDILFIWNDMNEPSVFRGPEQTMQKN
AIHHGNWEHRELHNIYGYYQQMATAEGLIQRSKGKERPFVLSRSFFAGSQKYGAVWTGDN
TAEWSYLKISIPMLLTLSITGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHASM
NTKRREPWLFGKEYTQLIREAIRERYTLLPYLYSLFYQAHVASEPVMRPLWIEFPNEVET
FGIEDEYMLGSALLVHPVTEPKATMVDVFLPGSNEIWYDPKTSACWEGGCTMKIPVALDT
GSAVGELYLDDGHSFRYLHQRQFLHRKLSFCSSVLTNSCADKSGHFPSKCVVEQILVLGL
RKEPSSVATHSSDGKAQPVAFVYCAGTSTLSLEKLSLNVDTDWEVRIQ
Download sequence
Identical sequences G5BM27
HGL_H00000326227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]