SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000326550-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000326550-2
Domain Number - Region: 564-685
Classification Level Classification E-value
Superfamily Tropomyosin 0.00105
Family Tropomyosin 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000326550-2
Sequence length 768
Comment TACC3 (Homo_sapiens) transforming, acidic coiled-coil containing protein 3
Sequence
MSLQVLNDENVTHEKSTENCDFLFSPPPHTGTTSVLGLSQKENVPPKNAAKATKVTFQTP
LRDPQTRRILSPNMTSKLETLLALDDSIRLEKSHYAWVQKETQQLPKDMDTMLPNGILQK
PAVAGAGLSPGDTTSASEDDSCSKPGPVHLADPRAPRSPQSLGSPENKMSPGQMSGSTGQ
ALKDSVSSQSSAESTPPTAEVLEDLPAPQHQVGTPPATLGGSPSSSAPAQAAVPGGPGAD
APPKDLPCPQNMALASPDPHREEAASQSAIDSRCEPIRLEFDFSDGAVSRRADPAWRQGK
RTKERQPQAPKKAEEGDRARGADETPALASRGSYHLNWDKLDDPNCNPFRGGSTLASKEA
LPPESPGARLATPAEDSPQSQGGMQPSAASLSRQMYAVPEDDRAEVQMAADTLSTEGQVQ
VYASASTCDLDCVLPAPSQPGPQPILNLEEESFRDPAEVLGTGAEVDYLEQFGTSSFKES
AWRKQSLYLKFDPLLKDSPLRPVPVVPVTDRVQGTEEPSSGNSTEARLVELDFLGVLDVP
VPGPPLNVLEPGGLPPPTRPIPIVDVLQYSQSDLDAAVSAAQEENKELRRRCEELQGKTL
EMGRIMDGFEGIVYQAMEDAQKQKELASTEIQRVLRERDQLTADLNSMEKSFSDLFKRFE
KQKEAIEGYQKNEESLKKCVEDYIARVEKEGQRYQALKAHAEEKLRLANEEIAQVRSKAQ
AEALAFQANLRKAQMQVQSLEKAVEQKTKENEELTRICDDLISKMEKI
Download sequence
Identical sequences G5BCI8
HGL_H00000326550-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]