SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000327179 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000327179
Domain Number 1 Region: 17-312
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.68e-44
Family WD40-repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 198-366,398-565
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 1.02e-28
Family DPP6 N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000327179
Sequence length 686
Comment CIRH1A (Homo_sapiens) cirrhosis, autosomal recessive 1A (cirhin)
Sequence
MGEFKVHRVRFFNYVPPGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHES
RATEALCWAEGQRLFSAGLNGEILEYDLQALNIKYAMDAFGGPIWSMIASPSGSQLLVGC
EDGSVKLFQITPDKIQFERNFDPQKSRVLSLSWHPSGTHIAAGSIDYISVFDVKSGSAIH
KMIVDRQYMGVSKRKCIVWGVAFLSDGTVISVDSAGKVQFWDSATGTLVKSHLIANADVQ
SIAVADQEDSFVVGTAEGTVFHFQLVSVTSNSTEKQWVRTKPFQHHTHDVRTVAHSPTAL
ISGGTDTHLVIRPLMEKVEVKNYDAALRKITFPHRRLISCSRKRQLLLFQFAHHLELWRL
GSTAATGKNGDILPLSKNADHLLHLKTKGPENIICSSISPCGSWIAYSTASRVFLYRLNY
EHDNISLQRISKMPAFLRSALQILFSEDSTKLFVASNQGSLHIIRLLEGSFKHLHTFQPQ
SGTVEAMCLLAVSPDGNWLAASGTSAGVHVYNVKHLKLHCTVPAYNFPVTALAIAPNTNN
LVIAHSDQQVFEYSIPDKQYTEWSRNVQKQGFHHLWLQRDTPITHISFHPKRPMHILLHD
AYMFCIIDKSLPLPNDKTVLYNPLPPTNESDVFRRRTGHAFKISKIYKPLLFMDLLDEGT
LVAVERPLDDIIAQLPPPIKKKKFGT
Download sequence
Identical sequences G5AK50
HGL_H00000327179 XP_004843014.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]