SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000327509 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000327509
Domain Number 1 Region: 131-235
Classification Level Classification E-value
Superfamily SH3-domain 4.72e-23
Family SH3-domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000327509
Sequence length 262
Comment STAC2 (Homo_sapiens) SH3 and cysteine rich domain 2
Sequence
MAGPPRPPIFQETPSRACASASFRRNFSSPLLVHEPPPACAASRESPPTGLGGKVDPVYE
TLRYGTSLALMNRSSFSSTSESPTRSLSEREELTEDGEGSIRSSEEGPSDSVFTALAESE
ESRAEERSPGQQPPRVPLRKEVGPMYSYVALYKFLPQESNDLALQPGDRILLVDDSNEDW
WKGKIGDRVGFFPANFVQRVRPSENVWRCCQPFSGNKEQGYLSLKENQICVGVGRARDGD
GFVRVSSGKKRGLVPADALSEI
Download sequence
Identical sequences G5BRW4
HGL_H00000327509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]