SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000327539 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000327539
Domain Number 1 Region: 274-363
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-23
Family Canonical RBD 0.00000559
Further Details:      
 
Domain Number 2 Region: 99-194
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.3e-21
Family Canonical RBD 0.00000598
Further Details:      
 
Domain Number 3 Region: 6-96
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000176
Family Canonical RBD 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000327539
Sequence length 470
Comment HNRNPH1 (Homo_sapiens) heterogeneous nuclear ribonucleoprotein H1 (H)
Sequence
MMLGTEGGEGFVVKVRGLPWSCSADXVFFPDCKIQNGAQGIRFIYTREGRPSGEAFVELE
SEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGC
SKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIE
IFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGG
YDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRATE
NDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKANMQHRYVELFLN
STAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGG
GYGGQSSMSGYGSQGAVNSSYYSSGSQASVGVNGVGGVSSMSSMSGGWGM
Download sequence
Identical sequences HGL_H00000327539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]